if folded, colorless if not . Protein tags find many other usages, such as specific enzymatic modification such as biotin ligase tags and chemical modification FlAsH tag. Often tags are combined to produce multifunctional modifications of the protein. However, with the addition of each tag comes the risk that the native function of the protein may be abolished or compromised by interactions with the tag. List of protein tags Isopeptag a covalently binding and genetically encoded tag BCCP Myc tag Calmodulin tag FLAG tag HA tag His tag Maltose binding proteintag Nus tag Glutathione S transferase tag Green fluorescent proteintag Thioredoxin tag S tag Softag 1 Softag 3 Strep tag SBP tag Ty tag Applications Affinity purification Protein array Western blotting Protein methods DEFAULTSORT ProteinTag Category Molecular biology Category Biochemistry methods Category Proteins Category Laboratory techniques de ProteinTag fr tiquette biologie ja ...Unreferenced date December 2009 Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes. Affinity tags are appended to proteins so that they can be purified from their crude biological source using an affinity technique. These include chitin binding protein CBP , maltose binding protein MBP , and glutathione S transferase GST . The poly histidine His tag is a widely used proteintag it binds to metal matrices ... of the protein to afford different resolution across a particular separation technique. Often, these consist of polyanionic amino acids, such as FLAG tag . Epitope tags are short peptide sequences ... include V5 tag , Myc c myc tag , and HA tag . These tags are particularly useful for western blotting ... tags are used to give visual readout on a protein. GFP and its variants are the most commonly ... more details
S tag is the name of an oligopeptide derived from pancreatic ribonuclease A RNase A . If RNase A is digested with subtilisin , a single peptide bond is cleaved, but the resulting two products remain weakly bound to each other and the protein, called ribonuclease S, remains active although each of the two products alone shows no enzymatic activity. The N terminus of the original RNase A, also called S peptide, consists of 20 amino acid residues, of which only the first 15 are required for ribonuclease activity. This 15 amino acid s long peptide is called S15 or S tag . The amino acid sequence of the S tag is Lys Glu Thr Ala Ala Ala Lys Phe Glu Arg Gln His Met Asp Ser. It is believed that the peptide with its abudance of charged and polar residues could improve solubility of proteins it is attached to. Moreover, the peptide alone is thought not to fold into a distinct structure. On DNA level the S tag can be attached to the N or C terminus of any protein . After gene expression , such a tagged protein can be detected by comercially availabe antibodies . References R.T. Raines et al., The S Tag Fusion System for Protein Purification. Methods Enzymol. 326, 362 367 2000 Category Peptides protein stub ... more details
glycerol Topological abelian group in mathematics Electronic Tag recording data on saltwater marine species Proteintag s, molecular markers to purify proteins by affinity methods Tumor associated ..., see Wikipedia WikiProject Microformats MediaWiki issues . Wiktionarypar tag TOCright Tag or tagging may refer to Personal identifiers Dog tag , a small, flat, metal identification label attached to a dog collar Dog tag military , a small, flat, metal identification label worn around the neck of military personnel Triage tag , a tool used by first responders and medical personnel at mass casualty ... uses Tag metadata , a keyword or term associated with or assigned to a piece of information TAG BBS , a DOS based bulletin board system software program Tag system , a deterministic computational model Knowledge tag , a type of meta information that captures knowledge about content, media, or data ... Revision tag , a textual label associated with a specific revision of a project HTML tag , part of an Hypertext Markup Language document Tag programming , a method for passing parameters to subroutines Tag editor , software for editing the metadata of multimedia files Meta element , also called Meta ... of Web architecture Techniques d Avant Garde , a Luxembourgian private holding company TAG Heuer , a Swiss watchmaker TAG Recordings , a record label Tag Entertainment TAG Entertainment , a United ... School for the Talented and Gifted , Dallas, Texas, USA Tag question , grammatical structure Tag LeapFrog , children s reading system Sports and entertainment Tag game , an informal playground game involving ... of Madagascar Tag out , a play in baseball Tag comics , the fictional character Brian Cruz TaG , Touch and Go class in karting Tag team , a group of two or more professional wrestlers. Tight aggressive, a form of poker strategy Tag The Power of Paint , a computer game TAGS, an acronym for The Andy Griffith Show Science and technology Skin tag , a small benign skin tumour Theoretical and Applied Genetics ... more details
Unreferenced date January 2008 TaG stands for Touch and Go , one of the fastest growing classes in Europe an kart racing . Popular engines include the Rotax Max , the Vortex Rok and the Parilla Leopard. In November 2004 the FIA announced that the new generation of engines used in the top classes, such as Formula A , would be TaG based in order to reduce costs. Regulations have been published and the engines have come into use in 2007. The new categories are KF1, KF2, KF3 and KF4, each category using the same 125 cc engine block with different technical specifications muffler s, air box es, carburetor , rev limit, etc... . External links http www.cikfia.com CIK FIA web site http www.karting1.co.uk Karting 1 Karting Information. Tips, Guides, Interviews, and Karting Features Category Kart models autoracing stub ... more details
, often a series of histidine residues a His tag , is attached to one terminus of the protein. As a result ...About a class of molecules protein as a nutrient Protein nutrient other uses pp semi indef pp move indef File Myoglobin.png thumb right 250px A representation of the 3D structure of the protein myoglobin showing colored alpha helix alpha helices . This protein was the first to have its structure solved ... compound compounds consisting of one or more polypeptide s typically folded into a globular protein globular or fibrous protein fibrous form in a biologically functional way. A polypeptide is a single ... acids in a protein is defined by the DNA sequence sequence of a gene , which is encoded in the genetic ... or even during synthesis, the residues in a protein are often chemically modified by post translational ... together to achieve a particular function, and they often associate to form stable protein complex complex ... to be single structure. Other proteins undergo large rearrangements from one protein conformation ... signaling event . Thus, the structure of a protein serves as a medium through which to regulate either the function of a protein or activity of an enzyme. Not all proteins requiring a folding process ... ingested protein into free amino acids that are then used in metabolism. Proteins were first described ... Jakob Berzelius in 1838. Early nutritional scientists such as the German Carl von Voit believed that protein ... urease was in fact a protein. ref name Sumner1926 The first protein to be protein sequencing .... The first protein structure s to be solved were hemoglobin and myoglobin , by Max Perutz and John ... may be protein purification purified from other cellular components using a variety of techniques such as ultracentrifugation .... Methods commonly used to study protein structure and function include immunohistochemistry , site ... protein folding the statistical analysis techniques employed to calculate a protein s probable ... bond that links individual amino acids to form a protein polymer Most proteins consist of linear polymer ... more details
Protein A is a 40 60 Atomic mass unit kDa MSCRAMM surface protein originally found in the cell wall of the bacteria Staphylococcus aureus . It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two component regulatory system two component system called ArlS ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins . It binds proteins from many of mammalian species, most notably IgG s. It binds with the Fc region ... antibody function on their surface which disrupts opsonization and phagocytosis . Protein A antibody .... Protein A binds with moderate affinity to human IgM , IgA and IgE as well as to mouse IgG3 and IgG1 .... Other antibody binding proteins In addition to Protein A, other immunoglobulin binding bacterial proteins such as Protein G , Protein A G and Protein L are all commonly used to purify, immobilize or detect immunoglobulins. Role in pathogenesis As a pathogen Staphylococcus aureus utilizes Protein .... Protein A helps inhibit phagocytic engulfment and acts as an immunological disguise. Mutants of S. aureus lacking protein A are more efficiently phagocytosed in vitro, and mutants in infection models ... 197 1125 1139. ref Research Recombinant Staphylococcal Protein A is often produced in E. coli for use in immunology and other biological research. One recombinant form of Protein A is called MabSelect ... 18114994AE.pdf ref . Protein A is often coupled to other molecules such as a fluorescent dye , enzyme ... widely utilized coupled to magnetic, latex and agarose beads. Protein A is often immobilized onto a solid support and used as reliable method for purifying total IgG from crude protein mixtures ... of antibodies. Immunoprecipitation studies with protein A conjugated to beads are also commonly used to purify proteins or protein complexes indirectly through antibodies against the protein or protein complex of interest. References reflist Category Proteins Category Staphylococcaceae de Protein ... more details
PBB geneid 5627 Protein S is a vitamin K dependent plasma glycoprotein synthesized in the endothelium. In the circulation, Protein S exists in two forms a free form and a complex form bound to complement system complement protein C4b. In humans, protein S is encoded by the PROS1 gene . ref name pmid2944113 ... J, Wydro R title Isolation and sequence of the cDNA for human protein S, a regulator of blood coagulation ... in Seattle, Wash, first discovered protein S and arbitrarily named it after the city of its ... title A comparison of human prothrombin, factor IX Christmas factor , factor X Stuart factor , and protein ... of protein S, a gamma carboxyglutamic acid containing protein from bovine and human plasma ... bi00572a026 ref Function The best characterized function of Protein S is its role in the anti coagulation pathway, where it functions as a cofactor to Protein C in the inactivation of factor V Factors ... journal author Castoldi E, Hackeng TM title Regulation of coagulation by protein S journal Curr. Opin ... url ref Protein S can bind to negatively charged phospholipids via the carboxylated Gla domain GLA domain . This property allows Protein S to function in the removal of cells which are undergoing ... membrane. These negatively charged phospholipids are recognized by phagocytes such as macrophages . Protein ... the apoptotic cell and the phagocyte. The bridging property of Protein S enhances the phagocytosis ... occurring. Pathology Mutations in the PROS1 gene can lead to Protein S deficiency ... of, and molecular defects underlying, inherited protein S deficiency in the general population ... Prior P, Hurtado B, Sala N title Molecular basis of protein S deficiency journal Thromb. Haemost ... Protein S has been shown to Proteinprotein interaction interact with Factor V . ref name pmid10593904 ... J, Tans G, Griffin J H year 1999 month Dec. title C terminal residues 621 635 of protein S are essential ... coauthors Mesters R M, Tans G, Rosing J, Griffin J H year 1993 month Feb. title Binding of protein ... more details
A myc tag is a polypeptide proteintag derived from the c myc gene product that can be added to a protein using recombinant DNA technology. It can be used for affinity chromatography , then used to separate recombinant, overexpressed protein from wild type protein expressed by the host organism. It can also be used in the isolation of protein complexes with multiple subunits. A myc tag can be used in many different assays that require recognition by an antibody . If there is no antibody against the studied protein, adding a myc tag allows one to follow the protein with an antibody against the Myc epitope. Examples are cellular localization studies by immunofluorescence or detection by SDS PAGE protein electrophoresis. The peptide sequence of the myc tag is N EQKLISEEDL C 1202 Da . It can be fused to the C terminus and the N terminus of a protein. It is advisable not to fuse the tag directly behind the signal peptide of a secretory protein, since it can interfere with translocation into the secretory pathway . A monoclonal antibody against the myc epitope , named 9E10, is available from the non commercial Developmental Studies Hybridoma Bank ref http dshb.biology.uiowa.edu c myc Developmental Studies Hybridoma Bank 9E10 ref . See also Polyhistidine tag , a different tag used in similar ways References references Category Biochemistry ... more details
FLAG tag , or FLAG octapeptide , is a polypeptide proteintag that can be added to a protein using recombinant DNA technology . It can be used for affinity chromatography , then used to separate Recombinant DNA recombinant , overexpressed protein from wild type protein expressed by the host organism. It can also be used in the isolation of protein complexes with multiple subunits. A FLAG tag can be used in many different bioassay assays that require recognition by an antibody . If there is no antibody against the studied protein, adding a FLAG tag to this protein allows one to follow the protein with an antibody against the FLAG sequence. Examples are cellular localization studies by immunofluorescence or detection by SDS PAGE protein electrophoresis. The peptide sequence of the FLAG tag is N DYKDDDDK C 1012 Da . It can be used in conjunction with other affinity tags, for example a polyhistidine tag His tag , HA tag or myc tag . It can be fused to the C terminus or the N terminus of a protein. Some commercially available antibodies e.g., M1 4E11 recognize the epitope only when it is present at the N terminal. However, other available antibodies e.g., M2 are position insensitive. The FLAG tag was the first example of a fully functional epitope tag to be published in the scientific ... tag to be patented ref Hopp, T.P., et al. 1987 Synthesis of protein with an identification peptide ... was first isolated against an existing protein, then the epitope was characterized and used as a tag ... for recombinant protein identification and purification. Bio Technology 6 1204 1210. http www.nature.com ... The FLAG peptide, a versatile fusion tag for the purification of recombinant proteins. J Biochem Biophys ... tag s structure has been optimized for compatibility with the proteins it is attached to, in that it is more ... . The first published report of another epitope tagging method HA tag ref J. Field, J ... testing as a kit for recombinant protein production. Protein tags Epitope tagging studies have ... more details
Unreferenced stub auto yes date December 2009 In molecular biology and biotechnology , a fluorescent tag is a part of a molecule that researchers have attached chemically to aid in detection of the molecule to which it has been attached. The tag is some kind of fluorescent molecule also known as fluorophore . Ethidium bromide , Fluorescein and Green fluorescent protein are common tags. See also Molecular tagging velocimetry DEFAULTSORT Fluorescent Tag Category Molecular biology Biochem stub ... more details
tag and streptavidin for detection and purification of recombinant proteins. Methods Enzymol 326, 271 304 ref Development and biochemistry of the Strep tag Streptavidin is a tetrameric protein expressed .... Acad. Sci. USA 94, 10547 10553. ref The Strep tag principle File Purification cycle strep tag .jpg thumb 370px right The Strep tagprotein purification cycle Just like other short affinity tags His tag ... tag is its rather small size and the fact that it is biochemically almost inert . Therefore, protein ... cycle, the cell lysate containing Strep tag fusion protein is applied to a column with immobilized ... Strep tag fusion protein is gently eluted with a low concentration of d desthiobiotin , which specifically ... purification run. Strep tag applications File Protein detection strep tag .jpg thumb 200px right Princible of chromogenic detection of Strep tagprotein with Strep Tactin alkaline phosphatase AP conjugate ... localization and targeting studies Because the Strep tag is capable of isolating protein complexes ... Tag Category Protein methods Category Biotechnology Category Molecular biology techniques Category ...File Strep tag struktur.jpg thumb 70px right Biochemical structure of the Strep tag The Strep tag system is a method which allows the purification and detection of protein s by affinity chromatography . The Strep tag is a synthetic peptide consisting of eight amino acids Trp Ser Histidine His Pro Gln ... crude cell lysates. Because the Strep tag elutes under gentle, physiological conditions it is especially suited for generation of functional proteins. ref Schmidt TGM and Skerra A, 2007. The Strep tag ... is commonly used in the fields of molecular biology and biotechnology . The Strep tag was originally ... of streptavidin. Over the years, the Strep tag was systemically optimized, to permit a greater flexibility ... called Strep tag system, consisting of Strep tag and Strep Tactin, has proven particularly useful for the functional isolation and analysis of protein complexes in proteome research. ref Ostermeier ... more details
. Affinity purification using a polyhistidine tag usually results in relatively pure protein when ... a protein of interest in a vector that has the tag ready to fuse at the C terminal. B The His ... where His tag is added will depend mainly on the characteristics of the protein and the methods chosen to remove the tag. Some ends are buried inside the protein core and others are important for the protein .... The most simple is to insert the DNA encoding the protein in a vector encoding a His tag ... 16 or more bases from one end of the DNA encoding the protein to be tagged, Media his tag primers.png ... next to the His tag. With 6 His the protein will have an added 1 kDa of molecular weight. Detection The polyhistidine tag can also be used to detect the protein via anti polyhistidine tag antibody ... . References references Protein methods DEFAULTSORT Polyhistidine Tag Category Molecular biology ... and subsequent buffers are manually poured into the column. A polyhistidine tag is an amino acid motif in protein s that consists of at least five histidine His residues, often at the N or C terminus of the protein. It is also known as hexa histidine tag , 6xHis tag , and by the trademarked name His tag registered by Merck KGaA EMD Biosciences . The tag was invented by Roche, ref http www.nature.com ... , GE Healthcare , Macherey Nagel, Clontech, and others. The use of the tag for academic users is unrestricted however, commercial users must pay royalties to Roche. Suitable tag sequences are available free for commercial use for example, MK HQ 6 may be used for enhanced expression in E. coli and tag removal. The total number of histidine residues may vary in the tag. The his tag may also be followed by a suitable amino acid sequence that facilitates a removal of the polyhistidine tag using endopeptidases ... observed when using endoprotease based tag removal. Polyhistidine tags are often used for Affinity chromatography ... Protein purification Polyhistidine tags are often used for affinity purification of polyhistidine ... more details
expert subject Molecular and Cellular Biology date December 2009 context date December 2009 Overview 38 amino acid s long peptide sequence that has nanomolar scale binding affinity to streptavidin . Sequence MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP what date December 2009 References reflist Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak, One Step Purification of Recombinant Proteins Using a Nanomolar Affinity Streptavidin Binding Peptide, the SBP Tag, Protein Expression and Purification, Volume 23, Issue 3, December 2001, Pages 440 446, ISSN 1046 5928, DOI 10.1006 prep.2001.1515. http www.sciencedirect.com science article B6WPJ 45BC2P7 B 2 ed500540db22d788854cefc60c32d2b2 microbiology stub Category Amino acids Category Microbiology Category Peptides Category Proteins ... more details
An identification tag might be Dog tag , an identification tag worn by dogs Dog tag identifier , an identification tag used by the military A Microchip implant animal radio identification tag , a scanner readable microchip implanted into livestock and pets for identication. Toe tag , identification tag used on the big toe of a dead person in a morgue Personal badge disambig ... more details
Tag League may refer to G1 Climax Tag League , a professional wrestling round robin tag team tournament held annually by New Japan Pro Wrestling Global Tag League , a professional wrestling round robin tag team tournament held annually by Pro Wrestling NOAH disambig ... more details
Toe Tag may refer to Toe tag , a tag typically attached to a dead person in a morgue Toe Tag American band , a band from Seattle, United States Toe Tag Estonian band , a hip hop group from Tallinn, Estonia Toe Tags CSI Toe Tags CSI , an episode of CSI disambig ... more details
Orphan date February 2009 Tag omission is an optional feature to minimize an Standard Generalized Markup Language SGML document. Whenever a tag can be implicitly anticipated by the parser from the structure of the document, the tag can be omitted. ref http www.is thought.co.uk book sgml 9.htm OMITTAG Web SGML and HTML 4.0 Explained Chapter 9 Bot generated title ref The tag omission feature can be generally enabled or disabled in the SGML Declaration. The Document Type Definition is used to enable or disable the tag for a specific tag. Tag omission is one of the main features of SGML which was removed from XML to simplify parsing. Example In this example the < document> tag has a distinct order of the tags. The information that < title> needs to come first and is followed by < p> can be used to omit the title start and end tag. Furthermore the end tag of < p> can also be omitted, because it will be delimited by the next < p> tag or the document end. source lang xml ELEMENT document O title, p ELEMENT title O O PCDATA ELEMENT p O PCDATA source In this DTD specification, the behavior of the tag omission feature is specified for each element by the two characters following the element name. The values can be or O for disabling and enabling the features. The first character specifies the behavior of the start tag and the second the behavior of the end tag. A valid document not using tag omission source lang xml document title Tag Omission title p first paragraph p p second paragraph p p third paragraph p document source A valid document simplified by using tag omission source lang xml document Tag Omission p first paragraph p second paragraph p third paragraph source References references DEFAULTSORT Tag Omission Category Markup language comparisons Category XML ... more details
Tag URI is a universal unique identifier protocol commonly used in various internet related technologies and associated with data storage and transfer systems such as YAML . ref name main cite web title Tag URI url http www.taguri.org accessdate 2007 11 02 ref ref name yaml spec cite web title YAML specification url http www.yaml.org spec current.html accessdate 2007 11 02 ref According to RFC 4151, a tag is a type of Uniform Resource Identifier URI designed to meet the following requirements ref RFC 4151 The tag URI Scheme ref Identifiers are likely to be unique across space and time, and come from a practically inexhaustible supply. Identifiers are relatively convenient for humans to mint create , read, type, remember etc. No central registration is necessary, at least for holders of domain names or email addresses and there is negligible cost to mint each new identifier. The identifiers are independent of any particular resolution scheme. Examples The following is an example tag that could be minted by a user to indicate authorship of a resource on the World Wide Web . The semantics of Tag URI do not require the user to currently have ownership of the Hostname upon which the tag is based, due to the date qualifier tag user example.com,2007 11 02 Tag URI The following example is a similar tag minted to indicate the name of the pet gerbil of the same user. Note that the semantics of Tag URI do not require the tagged entity to be accessible electronically tag user example.com,2006 Fluffy This demonstrates that the Tag URI scheme can be used to tag any entity, object or concept. See also UUID GUID References reflist URI scheme DEFAULTSORT Tag Uri Category URI schemes Category Internet standards Category Universal identifiers Category Indexing Category Identifiers compu network stub fr Tag URI ... more details
Image Eztag.jpg thumb An old EZ TAG EZ TAG is an electronic toll collection system in Houston, Texas ... roads. As of late 2003 the EZ TAG can also be used on all lanes of tolled roadways in Texas that accommodate ... TAG website, via telephone, or at one of the store locations. Next, the customers receive a small, white ... with sensors that can read EZ TAG transmitters and deduct the appropriate amount from their accounts. Image Eztag2.JPG thumb The inside of an old EZ TAG EZ TAG users are also unwitting participants ... to the Greater Houston Region. Houston Transtar uses EZ TAG sensors all over the city for their Automatic ... transponder tags EZ TAG users over the city, the system can generate real time traffic information for use by the general public. The personal information about the EZ TAG customer is not compromised in this process because the EZ TAG database and the AVI system are not interconnected. To the AVI system, an individual is just a number . The New EZ TAG In May 2006, HCTRA introduced a new version of the transponder tag. Instead of battery powered radio transmitters, the new tags are adhesive stickers with a button sized microchip in the middle of, and a reflective antenna system throughout the tag. These new tags are sold, rather than rented, so they help save money over the life of the tag by eliminating the monthly 1 rental fee. The battery tag s 15 security deposit can be applied to the purchase of the sticker tag. Removing the sticker after placement has a high probability of either ... invalidating the tag for future use. The tag also relies on the windshield for an amplification ... reduction is so much that not having a tag properly mounted will result in it not reading at all ... tag uses three different protocols, or communications methods, with the tag readers ATA, eGo and SeGo. The protocol used in Houston is ATA, however a driver in Houston can conceivably use the tag in another ... this happen. New EZ Tag Variations As of January 2008, three different sets of EZ Tags ... more details
Image Severn TAG logo.png thumb right The Severn TAG logo, used at toll collection area to indicate a TAG payment lane The Severn TAG is a payment system for collecting Toll bridge bridge tolls for drivers ... unit Tag on their windscreen to identify their vehicle as they drive through the toll lane. Lanes through the toll booths are dedicated as either Tag unstaffed , cash staffed or automatic coin bins ... toward the barrier before they operate due to the limited area in which the reader reads the tag. This prevents the complication of the old system where another tag user could enter the yellow box marking behind the user at the barrier and operate the system with their tag which would then cause ... to cross. Severn TAG types There are two types of Severn TAG Season Tag This type of tag allows the user to purchase a set period of time in which you can cross an unlimited amount of times, the tag ... if the user makes more than 17 journeys per month in a class 1 vehicle car when using this type of Tag. There are different levels of payment for different classes of vehicle. Trip Tag This type of tag is a pay per journey tag, useful if the user intends to make fewer than 17 journeys per month with a class ... then the Tag is declined and the user must have to pay with cash. The trip tag is transferable ... paying for the correct type of vehicle. Both types of Tag require a 30 Deposit. If the tag is lost ... TAG can only be used with one registered vehicle, this prevents misuse, however it complicates ... for Trip Tag users, and therefore little incentive to use it other than convenience. Non Tag users inadvertently drive into Tag only lanes and block the lane. The new tags are fairly large. On vehicles with metal lined heat reflective windscreens, the tag has to be placed in a zone near the rear view mirror which can be a distraction. It is not possible to add funds into a Trip Tag account online, or with a Credit Card or Debit Card . Administration of Severn TAG The tag is administered ... more details
Unreferenced date April 2008 Image Star Wars Tag & Bink Are Dead 01.jpg right thumb 200px Star Wars Tag & Bink Are Dead 1 October 2001 Tag and Bink are the main characters in a series of comic books spoofing Star Wars . Tag is from the planet Corellia and Bink is from Alderaan . The two first meet when they are found to have Force Star Wars Force potential. The comics illustrate how these two Jedi in training haphazardly cause all the pivotal events in the Star Wars fictional universe universe . Like other Star Wars comics, Tag and Bink is published by Dark Horse Comics . The whole Tag and Bink series is collected in Tag & Bink Were Here . Tag and Bink are the Rosencrantz and Guildenstern of the Star ..., the title of their initial appearance &mdash Tag and Bink Are Dead &mdash is a direct reference to the Tom Stoppard play Rosencrantz & Guildenstern Are Dead . Appearances Tag and Bink Are Dead 1 Tag ... that Vader is almost killed in the trenches of the Death Star, but due to Tag and Bink s lousy ... landing craft and escaped from the Death Star moments before it exploded. Tag and Bink Are Dead 2 The adventures of Tag and Bink continue as they venture through the events of the Star Wars original ... Palpatine . Tag and Bink eventually find themselves trapped on the second Death Star dressed as the Emperor ... destroy the space station, killing Tag and Bink in the process hence the title . Tag and Bink live on as Force ghost s, later to realize that they are trapped in purgatory . Tag and Bink Revenge of the Clone Menace main Tag and Bink Revenge of the Clone Menace This issue is a prequel to the previous Tag and Bink Are Dead issues. Tag and Bink are shown as children, haplessly trying to become Jedi ... eventually leaves Tag and Bink stranded on Naboo when he goes to Tatooine . It takes them three years ..., but warns them abandon their Jedi training. They do so. Tag and Bink Are Dead takes place about 20 years later. See also Troops film DEFAULTSORT Tag And Bink Category Dark Horse Comics titles Category ... more details
Unreferenced date January 2007 other uses Toe Tag disambiguation File Toe tag.jpg thumb 120px A toe tag on a toe of a dead body A toe tag is a piece of cardboard normally attached with string to the big toe of a Death dead person in a morgue . It is used for identification purposes, allowing the Funeral director morticians Coroner s, Law Enforcement and others involved in the death process to correctly identify the Body corpses . Usually it has the decedent s name, a case number if law enforcement is involved, and some descriptors like hair and eye color. However in many places actual toe tags are no longer used but have been replaced by wrist and or ankle bands which fulfil the same purpose. See also Body bag Dog tag Dog tag identifier DEFAULTSORT Toe Tag Category Death customs Category Undertaking ... more details
Tag Rugby , also known in the USA as flag rugby league or simply flag rugby , is a non contact team game ... by tagging pulling a velcro attached tag from the ball carrier, rather than a full contact tackle. Tag rugby is used in development and training by the rugby league community, but it is also used by the rugby union community as a development game training alternative. Tag Rugby comes in several forms with OzTag and Mini Tag being some of the better known variations. Tag Rugby has the highest participation levels in Ireland and Australia. Tag Rugby variants OzTag OzTag is a non contact form of rugby ... down field as close to the line as possible. Like most versions of tag rugby, a tackle is made ... the ball from playing a knock on advantage for instance or after the 4th tag. Mini Tag Like all forms of Tag Rugby Mini Tag is historically based on rugby league , but under 7s Mini Tag has ... tags law and instead tackled players must off load the ball. Under 8s Mini Tag on the other hand, retains a six tag law RFU Continuum 3.5.g which requires that on the 7th tag the referee will stop the game and give the ball to the other side. The restart is with a free pass. Mini Tag is currently the only .... Mini Tag requires the use of a size 3 rugby ball and does not allow scrum rugby scrums , line out s or kicking. Tag rugby worldwide Australia Since its beginnings in 1992, OzTag or Walla Tag has grown ... Nick Leonard Tag Rugby UK Limited brought the game of Tag Rugby to England from Australia in 1994. It runs leagues for adults in the UK. In 2003 4, the RFU introduced Mini Tag into its junior development program called The Three Stages of the Rugby Continuum , replacing touch rugby . Tag Rugby also ... in tournaments and friendly matches. Some developed into full contact teams, others became tag teams and others folded. In 2008, a Tag Merit League was established based on the RL Merit League format ... to play tag rugby league. The Merit League operates on normal rugby league laws with tags taking ... more details
otheruses Unreferenced date February 2008 Image WWE Triple Threat Tag Title Match in progress, RLA Melb 10.11.2007.jpg right thumb 350px Action in a triple threat tag team match for the World Wrestling Entertainment WWE World Tag Team Championship WWE World Tag Team Championship . Shelton Benjamin on the mat from The World s Greatest Tag Team has been isolated in the corner of champions Lance Cade ... tag in the third team, The Highlanders professional wrestling The Highlanders . Tag team professional wrestling is a variation in which matches are contested between teams of multiple wrestlers. A tag ... or legal wrestler may be transferred by physical contact, most commonly a palm to palm tag which ... twentieth century, and most promotions have sanctioned a championship division for tag teams. The term tag team has since become used in common parlance to describe two or more people who alternate or cooperate in participation in an activity, and tag teaming to describe the act of alternating with an ally, e.g. a couple tag teaming in an argument with another person. Image AMW.jpg thumb right ... Harris , James Storm and valet Gail Kim , a former tag team that wrestled for Total Nonstop Action Wrestling TNA . History In 1901 the first tag team match was held in the United States, in San Francisco. San Francisco promoters introduced tag team wrestling as a way of improving the sport s entertainment value. While tag team wrestling is now almost traditional in American professional wrestling ... World tag team championship was also crowned in San Francisco in the early 1950s. Tag team match rules Image Jeff Hardy Dropkick, RLA Melb 10.11.2007 filtered.jpg left thumb 250px A tag team match in progress ... , encourage them and reach for the tags. see Professional wrestling tag team match types The basic tag team match has two teams of two wrestlers facing off against each other. Only one wrestler from ... outside the ropes in a specified corner adjacent to the other team. Once a tag is made, the partners ... more details
Tag management is the ability to manage user generated tags or folksonomy within a collaborative software . Tag management features and processes are put in place to encourage cross user consistency, navigation efficiency and compliance with an existing taxonomy . Tag management a priori The tags that users will be able to use can be controlled up hill by Faceted classification , categorizing tags in facets e.g. organization or place facet Predefining tags , authority lists of tags can be created and suggested to users Restricting tag creation , allow users to create or not new tags other than predefined tags Mandatory facets , meaning a user must categorize each item with at least a tag from this facet Relating tags , meaning selecting a tag will also display the results of other tags related to it e.g. synonyms or translations Tag management a posteriori Tags can be gardened down hill by Renaming tags e.g. typos Deleting tags Moving tags to correct facets e.g. an organization name Merging tags e.g. single and plural words Examples of tag management Tag management applied to blogging tools Wordpress ref cite web url http en.support.wordpress.com posts tag management title Wordpress tag management publisher Wordpress accessdate 2010 07 26 ref Tag management applied to Content management systems Microsoft SharePoint ref cite web url http www.cmswire.com cms document management overview sharepoint 2010 metadata and taxonomy management 006015.php title SharePoint 2010 metadata and taxonomy management publisher CMS Wire accessdate 2010 07 26 ref Tag management applied to Enterprise bookmarking tools Jumper 2.0 , Knowledge Plaza References references Category Knowledge management Category Folksonomy Category Taxonomy Category Collaborative software ... more details