Search: in
Demographics of Latvia
Demographics of Latvia in Encyclopedia Encyclopedia
  Tutorials     Encyclopedia     Videos     Books     Software     DVDs  
       
Encyclopedia results for Demographics of Latvia

Demographics of Latvia





Encyclopedia results for Demographics of Latvia

  1. Demographics of Latvia

    Statistics Demographics of Europe DEFAULTSORT Demographics Of Latvia Category Demographics by country ...File Population of Latvia.PNG thumb 400px right Population of Latvia in millions from 1950 2010. This article is about the demographics demographic features of the population of the historical territory of Latvia , including population density , Ethnic group ethnic background , education level, health ... Latvia was settled by the Baltic tribes some three millennia ago. The territories along the eastern ... establishment of Riga in 1201 under the German Teutonic Knights . Latvia, in whole or in parts, remained ... , Sweden , and Russia , with southern Courland Latvia being at one time a vassal to Poland Lithuania as well as Latgale falling directly under Poland Lithuania rule. Through all this time, Latvia ..., a situation which did not change until Latvia s independence. Historically, Latvia has had significant ..., even through to today. Historical shifts Latvia s indigenous population has been ravaged numerous times throughout history. The earliest such event occurred during the conquest of Latvia by Peter ..., and various other nationalities. The demographics shifted greatly in the 20th century due to the world ... 58.8 of the inhabitants . People who arrived in Latvia during the Soviet era, and their descendants ... citizens since 1995, but 351,435 persons 231,711 of them ethnic Russians , as of July 2009, live in Latvia ... remained in Latvia after the fall of the Soviet Union. Latvians and Livonians , the indigenous peoples of Latvia, are now when date February 2011 60 of the population. Livonians are the other indigenous ... Country Rankings, Latvia is estimated to have a population of 1,544,000 in the year 2050. Ethnic groups class wikitable Population of Latvia according to ethnic group 1925 2011 bgcolor e0e0e0 rowspan ... ethnicities statistics.htm title Ethnicities in region of Latvia. Statistics publisher roots ... www.mfa.gov.lv lv latvia integracija integracijas politikacopy ref colspan 2 2011 ref name csb http ...   more details



  1. Demographics

    types of demographics for marketing are age, gender, income level, race and ethnicity. Generational ... Demographics An analysis of the effect of changing demographic patterns on school enrollments ...?TERM DEMOGRAPHICS DEMOGRAPHICS Demographics as a term in Economics Demographics by continent Category Demographics Category Consumer behaviour Category Market research Category Demographic economics ...   more details



  1. Outline of Latvia

    main Demographics of Latvia Government and politics of Latvia Main article Government of Latvia and Politics ...double image right Flag of Latvia.svg 210 Coat of Arms of Latvia.svg 132 The Flag of Latvia The Coat of arms of Latvia Image LocationLatvia.svg thumb The location of Latvia Image Un latvia.png thumb An enlargeable map of the Republic of Latvia The Republic of Latvia is a List of sovereign states sovereign ... Latvia work The World Factbook publisher United States Central Intelligence Agency accessdate July 23, 2009 ref Latvia is bordered to the north by Estonia 343  km , to the south by Lithuania 588  ... the Baltic Sea to the west lies Sweden . The territory of Latvia covers 64,589  km and is influenced ... of the Baltic peoples and Baltic languages of the Indo European family. The modern name of Latvia is thought to originate from the ancient Latvian name Latvia Latvji , which may have originated from the word Latve which is a name of the river that presumably flowed through what is now eastern Latvia. Citation needed date July 2008 Latvia is a democratic parliamentary republic and is divided into 26 Districts of Latvia districts . The capital and largest city is Riga . Latvia has been a member ... since 29 March 2004. The following outline is provided as an overview of and topical guide to Latvia TOC limit limit 2 General reference Image Latvia 1998 CIA map.jpg thumb An enlargeable relief map of Latvia Pronunciation IPA en l tvi Common English country name Latvia Official English country name The Republic of Latvia Common endonym s List of countries and capitals in native languages Latvija ... and demonymic forms of place names Countries and nations Demonym s Latvian Etymology Name of Latvia International rankings of Latvia ISO country codes LV, LVA, 428 ISO region codes See ISO 3166 2 LV Internet country code top level domain .lv Geography of Latvia image Topographic Map thumb An enlargeable topographic map of Latvia See also Geography of Latvia Latvia is a Nation state country Location ...   more details



  1. Regions of Latvia

    The regions of Latvia can refer to the Administrative regions of Latvia Cultural regions of Latvia Disambig ...   more details



  1. Young Latvia

    Young Latvia may refer to Young Latvia movement , Latvia, 19th century Jaunlatvija , political party, Latvia, 21st century Jaun Latvija , an extreme right party, Latvia, 1933 1934 disambig ...   more details



  1. Russians in Latvia

    Russian ethnicity Russians have been the largest ethnic minority in Latvia for the last two centuries. Infobox Ethnic group group Russians in Latvia poptime 606,972 2011 27.3 of total population popplace R ga , Daugavpils , R zekne Ancient Latvia The Latvian word krievi for Russians and Krievija for Russia ... , principalities in Eastern Latvia paid tribute to the Principality of Polatsk . Livonia Koknese was taken ... Latvia and held some of them even for 4 years. From the second half of the seventeenth century ... Livonia . Russian trade through Latvia began to flourish and an active Russian merchant class began to settle in Latvia. The first Russian school in Riga was founded in 1789. ref http www.dialogi.lv ... in trade through the Baltic countries, including Latvia. Some of those profits went toward establishing ... 15, 1869 While the Russian community in Latvia was largely an extension of Russia s ethnic Russians ... Russians were beginning to consider themselves one of the nationalities of Latvia. ref http www.li.lv index.php?option com content&task view&id 101&Itemid 470 Russians in Latvia at the Latvian Institute ... of the empire, further stimulated the rise of a national consciousness. Latvia had, in fact, taken a lead ... in schooling and through the colonization of Latvia by Russian peasants. Colonization was successful ... industrial cities. In Latvia, as in the rest of the Russian empire, the situation of factory workers ... the revolution spread to Latvia, it can be argued that Latvia was far more prepared for it than Russia ... in Latvia, the Baltic German elite, was a clear and unambiguous target a separate social class of separate ethnicity speaking a separate language. Thus the 1905 revolution in Latvia was fundamentally ... captured small towns and burned dozens of manors. The revolution in Latvia, however, did not agitate ... Revolution of 1917 Revolution of 1917 . In 1917, as in 1905, it can again be argued that Latvia ..., nor did it target the influx of Russians who fled to Latvia after 1917 to escape the Russian Soviet ...   more details



  1. Renda, Latvia

    Unreferenced date October 2006 The Renda parish Lang lv Rendas pagasts is located in the Kuld ga municipality of Latvia . Coord missing Latvia Category Parishes of Latvia courland geo stub ...   more details



  1. Law of Latvia

    image Saeima.JPG thumb Saeima , parlament of Latvia Latvian law is a part of a legal system of Latvia . It is largely civil law legal system civil , as opposed to a common law common , law system, based on epitome s in the German law German and French law French systems. The Latvian legal system is grounded on the principles laid out in the Constitution of Latvia Constitution of the Republic of Latvia and safeguarded by the Constitutional Court of the Republic of Latvia . History During the Soviet occupation the adapted Soviet law law of the USSR was in force in Latvia. The European Union law is an integral part of the Latvian legal system since 1 May 2004. Human rights in Latvia main Human rights in Latvia Capital punishment in Latvia main Capital punishment in Latvia See also Declaration On the Restoration of Independence of the Republic of Latvia Legal systems of the world Law of Europe DEFAULTSORT Law Of Latvia Category Latvian law lt Latvijos teisin sistema ...   more details



  1. Latvia (disambiguation)

    Latvia is a country in Europe. Latvia can also refer to Latvian Soviet Socialist Republic 1940 1991 Latvia European Parliament constituency See also Category National sports teams of Latvia dab lv Latvija noz mju atdal ana ...   more details



  1. Hinduism in Latvia

    Hinduism in Latvia is a minor religion, spread mainly by ISKCON and Brahma Kumaris . ISKCON started in Latvia in the early eighties. As of April 2006, 11 congregations of Hare Krishna ISKCON are registered in Latvia. ref name irf http www.state.gov g drl rls irf 2006 71390.htm International Religious Freedom Report 2006, Latvia ref In 2005, Hare Krishna gave its membership figures as 127 to the Justice Ministry. ref name irf ISKCON maintains a temple in Riga and organizes annual festival Ratha Yatra. Brahma Kumaris have three centres in Latvia in Riga, Daugavpils , and R zekne . ref http www.bkwsu.org whereweare center Brahma Kumari Centre in Latvia ref References reflist External links http www.iskcon.com icj 1 2 12latvia.html A Case Study of ISKCON Latvia Hinduism in Europe Category Religion in Latvia Category Hinduism in Europe Latvia Category Hinduism by country Latvia ...   more details



  1. Football in Latvia

    Football is not Latvia s national sport, however, in recent years it has gained popularity. Latvian football is lead by the Latvian Football Federation . See also National Teams Latvia national football team Latvia national under 21 football team Latvia national under 19 football team Latvia national under 17 football team Women s Teams Latvia women s national football team Leagues Latvian Higher League Latvian First League Latvian Second League Women s Leagues Latvian Women s League Clubs main List of football clubs in Latvia Competitions Latvian Football Cup Football in Latvia Football in Europe footy stub Latvia sport stub Category Football in Latvia az Latviya futbolu de Fu ball in Lettland pt Futebol na Let nia ru ...   more details



  1. 1284 Latvia

    Infobox planet width 25em bgcolour FFFFC0 apsis name Latvia symbol image caption discovery yes discovery ref discoverer Karl Wilhelm Reinmuth K. Reinmuth discovery site Landessternwarte Heidelberg K nigstuhl Heidelberg discovered July 27, 1933 designations yes mp name 1284 alt names 1933 OP named after Latvia mp category orbit ref epoch May 14, 2008 aphelion 3.098569803395093 perihelion 2.192105822650204 semimajor eccentricity .1713323675113414 period 1571.520811384944 avg speed inclination 10.88031668797016 asc node 303.0609763066931 mean anomaly 65.36806788593057 arg peri 114.6809032621485 satellites physical characteristics yes dimensions mass density surface grav escape velocity sidereal day axial tilt pole ecliptic lat pole ecliptic lon albedo 0.1045 temperatures temp name1 mean temp 1 max temp 1 temp name2 max temp 2 spectral type abs magnitude 10.24 1284 Latvia 1933 OP is a Asteroid belt main belt asteroid discovered on July 27, 1933 by Karl Wilhelm Reinmuth K. Reinmuth at Landessternwarte Heidelberg K nigstuhl Heidelberg . It is named after the Latvia Republic of Latvia . External links http ssd.jpl.nasa.gov sbdb.cgi?sstr 1284 Latvia JPL Small Body Database Browser on 1284 Latvia Minor planets navigator 1283 Komsomolia 1285 Julietta Small Solar System bodies DEFAULTSORT Latvia Category Main Belt asteroids Category Discoveries by Karl Wilhelm Reinmuth Category Asteroids named for places Category Astronomical objects discovered in 1933 Beltasteroid stub de 1284 Latvia el 1284 eo 1284 Latvio eu 1284 Latvia fa it 1284 Latvia la 1284 Latvia hu 1284 Latvia ja no 1284 Latvia nn 1284 Latvia pl 1284 Latvia pt 1284 Latvia ru 1284 sk 1284 Latvia sr 1284 tl 1284 Latvia uk 1284 vi 1284 Latvia yo 1284 Latvia ...   more details



  1. Georgians in Latvia

    Ethnic Georgians in Latvia number around 1500. ref http diaspora.gov.ge index.php?lang id GEO&sec id 64&info id 272 Georgians in Latvia ref ref http www.georgia.lv Sam oblo Georgia ref ref http latvia.mfa.gov.ge Georgian Embassy in Latvia ref References Reflist Latvia stub Category Georgian diaspora Category Ethnic groups in Latvia ...   more details



  1. Ance, Latvia

    Ance is a village in Ventspils municipality , Latvia . See also Ance parish coord 57 30 46 N 22 01 22 E display title Courland geo stub Category Towns and villages in Latvia ...   more details



  1. 2011 in Latvia

    Events in the year 2011 in Latvia . Incumbents List of Presidents of Latvia President Valdis Zatlers Prime Minister of Latvia Prime Minister Valdis Dombrovskis Events Latvian presidential election, 2011 Arts and entertainment In music Latvia in the Eurovision Song Contest 2011 . Sports Association football Football soccer competitions 2010 11 Baltic League Baltic League , 2011 Latvian Higher League Latvian Higher League , 2010 11 Latvian Football Cup Latvian Football Cup . See also List of Latvian football transfers winter 2010 2011 . Deaths Empty section date January 2011 References reflist Unreferenced date January 2011 Europe topic 2011 in DEFAULTSORT 2011 in Latvia Category 2011 in Europe Latvia Category 2011 in Latvia Category Years of the 21st century in Latvia lv 2011. gads Latvij ...   more details



  1. Aerodium Latvia

    Aerodium Latvia is a company based in Sigulda , Latvia , which owns and runs the first vertical wind tunnel in Eastern Europe . The vertical wind tunnel VWT is located near Sigulda , the most visited tourist area in Latvia. The company became known after the 2006 Winter Olympics 2006 Torino XX Winter Olympic Games closing ceremonies, because Aerodium Latvia helped produce the part of the show that featured flying acrobats. The tunnel blows a wind stream of 200 km h within a diameter of 3.7 meters. External links http www.aerodium.lv Aerodium Latvia s official website http www.aerodium.lv en gallery video olimpiade 1813 Video of the Aerodium section of the Torino closing ceremonies Windows Media Player Category Companies of Latvia latvia stub ru ...   more details



  1. Districts of Latvia

    Politics of Latvia Before July 1, 2009 Latvia was divided into 26 districts rajons pl. rajoni and 7 cities lielpils tas singular ndash lielpils ta , indicated with asterisks for new administrative divisions see Administrative divisions of Latvia 2009 col begin width auto col 2 Aizkraukle District Al ksne District Balvi District Bauska District C sis District Daugavpils District Daugavpils Dobele District Gulbene District J kabpils District Jelgava District Jelgava J rmala Kraslava District Kr slava District Kuld ga District Liepaja District Liep ja District Liep ja Limba i District Ludza District Madona District Ogre District Preili District Prei i District Rezekne District R zekne District R zekne Riga District Riga Saldus District Talsi District Tukums District Valka District Valmiera District Ventspils District Ventspils col 2 Image Latvia districts numbered.png thumb 350px Districts of Latvia col end Labelled map Latvia Labelled Map See also Administrative divisions of Latvia Administrative divisions of Latvia pre 2009 Administrative regions of Latvia Cultural regions of Latvia ISO 3166 2 LV List of Latvian districts Categories Category Districts of Latvia Category Subdivisions of Latvia Category Lists of country subdivisions Latvia, Districts Category Former subdivisions of countries Latvia Category Latvia related lists Other languages bg da Letlands distrikter de Verwaltungsgliederung Lettlands eo Distriktoj de Latvio es Organizaci n territorial de Letonia eu Letoniaren banaketa administratiboa fr Rajons de Lettonie gl Distritos de Letonia it Distretti della Lettonia he lv Latvijas rajoni lt Latvijos rajonai hu Lettorsz g j r sai nl Bestuurlijke indeling van Letland ja no Latvias fylker pl Podzia administracyjny otwy pt Distritos da Let nia ro Raioanele Letoniei ru sr bat smg Latv j s rajuon ...   more details



  1. Television in Latvia

    Television in Latvia was first tested in 1937 Timeline of the introduction of television in countries and introduced in 1954 . This is a list of television channels that broadcast for a Latvian language audience. State owned Latvijas Telev zija LTV1 national television Latvijas Telev zija LTV7 national television Private TV3 Latvia TV3 3 Latvia TV3 Russian version for Latvia TV6 Latvia TV6 LNT Latvia LNT TV5 Riga TV5 Nickelodeon Russia Channel One Russia First Baltic Channel Latvia Pirmais Baltijas kan ls Pervy Baltiysky Kanal Entirely in Russian language Russian TV XXI MTV Latvija localized version of MTV Baltic OE TV LMK Latvijas M zikas kan ls Latvian Music Channel LZK Latvijas Zi u kan ls Latvian News Channel TV24 Latvia TV24 a news channel by LETA Local regional TV stations TV Dzintare only in Liep ja Lemon TV Cable TV Latvia , DVB T only in Vidzeme area http lemontv.lv Lemon TV Latvia webpage LRT Latgalian Regional Television only in Latgalia VTV Ventspils TV only in Ventspils OTV Ogres TV only in Ogre, Latvia Ogre TV Miljons only in Daugavpils TV DAUTKOM cable TV, only in Daugavpils Valmieras TV only in Valmiera TV Vi ni only in Vi ni One of the smallest TV stations in the world 2 people http www.diena.lv lat politics sestdiena pasi mazakie Latvian Story in Diena , probable liquidation in 2009 due to economic status http www.lursoft.lv appserver3?Form URpCI&code GKAWQGCHARHGEDAEWLVNQCPFWQFMNL&l lv Latvian Lursoft business database Television in Europe Category Latvian media Television channels Category Television in Latvia Category Latvia related lists Television Latvia tv stub lv Telev zija Latvij ru ...   more details



  1. Government of Latvia

    Politics of Latvia The Government of Latvia is the central government of the Republic of Latvia . The Constitution of Latvia Satversme outlines the nation as a parliamentary republic represented by a unicameral parliament Saeima and the Cabinet of Ministers of the Republic of Latvia, which form the executive branch of the Government of Latvia. Current Cabinet of Ministers class wikitable Position Name colspan 2 Party Prime Minister of Latvia Prime Minister Valdis Dombrovskis width 5px style background color Unity Latvia meta color Unity Latvia Unity Deputy Prime Minister of Latvia Deputy Prime Minister br Minister for Defence of Latvia Minister for Defence Artis Pabriks style background color Unity Latvia meta color Unity Latvia Unity Minister for Foreign Affairs of Latvia Minister for Foreign ... Minister for Economics of Latvia Minister for Economics Daniels Pav uts style background color Zatlers Reform Party meta color Zatlers Reform Party Minister for Finance of Latvia Minister for Finance Andris Vilks style background color Unity Latvia meta color Unity Latvia Unity Minister for the Interior of Latvia Minister for the Interior Rihards Kozlovskis style background color Zatlers Reform Party meta color Zatlers Reform Party Minister for Education and Science of Latvia Minister for Education ... politician Independent Minister for Culture of Latvia Minister for Culture aneta Jaunzeme Grende style background color National Alliance Latvia meta color National Alliance Latvia National Alliance Minister for Welfare of Latvia Minister for Welfare Ilze Vi ele style background color Unity Latvia meta color Unity Latvia Unity nowrap Minister for Environmental Protection and Regional Development ... for Transport of Latvia Minister for Transport Aivis Ronis style background color Independent politician meta color Independent politician Independent Minister for Justice of Latvia Minister for Justice Gaidis B rzi style background color National Alliance Latvia meta color National Alliance ...   more details



  1. Elections in Latvia

    Politics of Latvia Elections in Latvia gives information on election and election results in politics of Latvia Latvia . Latvia elects on national level a legislature . The Saeima has 100 members, elected for a four year term by proportional representation with a 5 threshold. An unmodified Sainte Lagu method is used to allocate seats. The parliamentary elections are held on the first Saturday of October. Locally, Latvia elects municipal councils, consisting of 7 to 60 members, depending on the size of the municipality, also by proportional representation for a four year term. Latvia has a multi party system, with numerous political parties parties in which no one party often has a chance of gaining power alone, and political parties parties must work with each other to form coalition government s. 2011 Parliamentary election Main Latvian parliamentary election, 2011 A parliamentary election was held on 17 September 2011. 2010 Parliamentary election Main Latvian parliamentary election, 2010 Latvian parliamentary election, 2010 Past elections and referendums Latvian elections Past elections Saeima parliament 1993, 1995, 1998, 2002, 2006, 2010 Local municipal 1994, 1997, 2001, 2005, 2009 Europarliament 2004 9 seats , 2009 8 seats 1 in case of Lisbon treaty coming into force Referenda 1998 citizenship 1999 pensions 2003 EU 2007 national security law 2008 pensions Presidential 1993, 1996, 1999, 2003, 2007 See also Electoral calendar Electoral system Latvian parliamentary election, 2010 External links http psephos.adam carr.net countries l latvia Adam Carr s Election Archive http www.parties and elections.de latvia.html Parties and Elections in Europe http www.cvk.lv cgi bin wdbcgiw base saeima9.GalRezS9.vis National Elections Commission of Latvia http www.osce.org odihr elections ... latvia NSD European Election Database Latvia publishes regional level election data allows for comparisons ... in Latvia Latvia election stub it Politica della Lettonia ...   more details



  1. Liberalism in Latvia

    to form LPP LC . German Baltic Democratic Party 1918 Moderate German liberals in Latvia formed the German ... Baltic Progressive Party 1918 Radical German liberals in Latvia formed the German Baltic Progressive ... Latvia Democratic Party Demokr tisk Partija merged with the Radical Democratic Party and the People s Party au u Partija into the Democratic Centre Latvia Democratic Centre Demokr tiskais Centrs . The party is led by the later presidents of Latvia, J nis akste and Gustavs Zemgals . 1934 The party ... left to join the Labour Party Latvia Labour Party and the Latvian National Reform Party 1999 The party is renamed Latvian Democratic Party Latvijas demokr tisk partija Latvia s Way 1993 Liberals from the Popular Front of Latvia formed the Latvian Way Latvia s Way Latvijas Ce 2006 Latvia s Way forged an alliance with the Latvia s First Party , forming the LPP LC . 2010 LPP LC joined hands with the People s Party Latvia People s Party to form the For a Good Latvia Par Labu Latviju alliance. 2011 People s Party Latvia People s Party is disbanded, so is the PLL alliance. Liberal leaders Demokratiskais Centrs J nis akste See also History of Latvia Politics of Latvia List of political parties in Latvia Liberalism in Europe DEFAULTSORT Liberalism In Latvia Category Liberalism by country Latvia Category Politics of Latvia liberal stub ...   more details



  1. PrivatBank (Latvia)

    AS PrivatBank is a subsidiary at the Ukraine Ukrainian privately held banking company PrivatBank . Prior to 16 August 2007 the bank was known as AS Banka Parit te . Category Banks of Latvia Category Companies based in Riga Latvia stub uk ...   more details



  1. Soviet Latvia

    The term Soviet Latvia usually refers to the Latvian SSR , a Union Republic of the USSR from 1940 to 1991. It may also refer to other periods of communist government on the territory of present day Latvia, e.g. the so called Iskolat Republic 1917 1918 the Latvian Socialist Soviet Republic 1918 1920 Other uses Sovetskaya Latviya Soviet Latvia , a Russian language daily newspaper published in the Latvian SSR MV Sovetskaya Latviya Soviet Latvia , a transport ship operated by the Soviet industrial concern Dalstroy , a part of the NKVD s forced labour system. disambig ...   more details



  1. University of Latvia

    Infobox University name University of Latvia native name Latvijas Universit te image File University of Latvia emblem.png Logo of the University of Latvia latin name Universitas Latviensis motto Scientiae ... doctoral 853 2011 divinity residents 248 2011 other profess alumni city Riga country flagicon Latvia Latvia address Rai a bulv. 19 sports colors colours nickname mascot fightsong athletics affiliations ... logo publictransit footnotes University of Latvia LU lang lv Latvijas Universit te is a university located in Riga , Latvia . Established in 1919 , University of Latvia is the biggest university in the Baltic states . History The University of Latvia named at that time The Latvia Higher School ... name the University of Latvia Universitas Latviensis . In the period between 1919 and 1940, the University of Latvia was the greatest center of higher education, science and culture in Latvia. The former ... at the University of Latvia but also at the Latvian State Conservatoire Conservatoire of Latvia and Latvian ... Technical University separated from the University of Latvia and became well known centers of education and research. With Latvia regaining independence the Supreme Council of the Republic of Latvia confirmed the Constitution of the University of Latvia on September 18, 1991. It stated that the Higher ... of Latvia and people . ref http www.lu.lv dokumenti satversme.html LU.lv ref Alongside the Constitution ... for the Rector, Vice Rector and deans were renewed as attributes of the University of Latvia. Enrollment The University of Latvia offers undergraduate, graduate, and doctoral levels of study and in January ... of Computing. In addition to the university s various faculties, the University of Latvia offers most ... poet Valdis Dombrovskis , Politics of Latvia Latvian politician , current Prime Minister of Latvia ... of Latvia Latvian politician , former Prime Minister of Latvia , Member of the European Parliament ... on the foundation of mildronate Guntars Krasts , Politics of Latvia Latvian politician , former Prime ...   more details



  1. NUTS of Latvia

    nuts nuts 2008.ods Download current NUTS codes ODS format http www.statoids.com ulv.html Districts of Latvia , Statoids.com NUTS Category NUTS Latvia Category Subdivisions of Latvia Nuts hu NUTS LV ...   more details




Articles 1 - 25 of 93547          Next


Search   in  
Search for Demographics of Latvia in Tutorials
Search for Demographics of Latvia in Encyclopedia
Search for Demographics of Latvia in Videos
Search for Demographics of Latvia in Books
Search for Demographics of Latvia in Software
Search for Demographics of Latvia in DVDs
Search for Demographics of Latvia in Store


Advertisement




Demographics of Latvia in Encyclopedia
Demographics of Latvia top Demographics of Latvia

Home - Add TutorGig to Your Site - Disclaimer

©2011-2013 TutorGig.com. All Rights Reserved. Privacy Statement